You are here: Homepage » Product details for "D4 zinc and double PHD fingers family 2 DPF2 Human"

Product details for D4, zinc and double PHD fingers family 2 (DPF2) (Human) a...

Print Version

D4, zinc and double PHD fingers family 2 (DPF2) (Human) antibody

Overview


	Antigen:	D4, zinc and double PHD fingers family 2 (DPF2)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl (Product variants)
	Price:	350,75 $ (Plus shipping costs , $13.59 dry ice fee and VAT, Invoice in EUR)
	Order number:	ABIN171043
	Availability:	Delivery in 7 to 10 days

Antigen	D4, zinc and double PHD fingers family 2 (DPF2)
Gene ID	5977
Immunogen	DPF2 (AAH14889, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEG LISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK
Reactivity	Human
Antibody Type	Polyclonal
Description	D4, zinc and double PHD fingers family 2 The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. Mouse polyclonal antibody raised against a partial recombinant DPF2. Synonyms: MGC10180, REQ, UBID4, ubi-d4
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (34.00 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (34.00 KDa) .

Image for D4, zinc and double PHD fingers family 2 (DPF2) (Human) antibody (1)

Google Scholar	Find more references for antigen DPF2 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen DPF2 (Bioinformatic Harvester (EMBL))