Sie sind hier: Startseite » Produktdetails für "DAZ associated protein 2 DAZAP2 Human"

Produktdetails für DAZ associated protein 2 (DAZAP2) (Human) antibody

Druckversion

DAZ associated protein 2 (DAZAP2) (Human) antibody

Übersicht


	Antigen:	DAZ associated protein 2 (DAZAP2)
	Antikörper-Typ:	Polyklonal
	Applikation:	Western Blotting (WB), ELISA
	Reaktivität:	Human
	Wirt:	Mouse
	Menge:	50 µl
	Preis:	258,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt)
	Bestellnummer:	ABIN171823
	Verfügbarkeit:	Delivery in 7 to 10 days

Antigen	DAZ associated protein 2 (DAZAP2)
Gen-ID	9802
Immunogen	DAZAP2 (NP_055579, 93 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANV LVTQRKGNFFMGGSDGGYTIW*
Reaktivität	Human
Antikörper-Typ	Polyklonal
Beschreibung	DAZ associated protein 2 In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region and is deleted in many azoospermic and severely oligospermic men. It is thought that the Y chromosomal DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Mouse polyclonal antibody raised against a partial recombinant DAZAP2. Synonyms: KIAA0058, MGC14319, MGC766
Wirt	Mouse

Applikation	Western Blotting (WB), ELISA
Applikationshinweise	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (34.47 KDa) .
Lagerung	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Beschränkungen	For Research Use only

Western Blot detection against Immunogen (34.47 KDa) .

Bild für DAZ associated protein 2 (DAZAP2) (Human) antibody (1)

Google Scholar	Suchen Sie in Google Scholar™ nach weiteren Artikeln für Antigen DAZAP2
EMBL Harvester	Genom von Mensch, Maus oder Ratte nach Antigen DAZAP2 durchsuchen (Bioinformatic Harvester (EMBL))