PANIER
AIDE
Antigènes
Détail du produit pour DAZ associated protein 2 (DAZAP2) (Human) antibody
DAZ associated protein 2 (DAZAP2) (Human) antibody
Aperçu
|
|
| Antigène: | DAZ associated protein 2 (DAZAP2) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN171823 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: DAZ associated protein 2 (DAZAP2) (Human) antibody
| Antigène | DAZ associated protein 2 (DAZAP2) |
| ID gène | 9802 |
| Immunogène | DAZAP2 (NP_055579, 93 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANV LVTQRKGNFFMGGSDGGYTIW* |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | DAZ associated protein 2 In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region and is deleted in many azoospermic and severely oligospermic men. It is thought that the Y chromosomal DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Mouse polyclonal antibody raised against a partial recombinant DAZAP2. Synonyms: KIAA0058, MGC14319, MGC766 |
| Hôte | Mouse |
Applications: DAZ associated protein 2 (DAZAP2) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (34.47 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: DAZ associated protein 2 (DAZAP2) (Human) antibody
|
Western Blot detection against Immunogen (34.47 KDa) . |
Informations supplémentaires: DAZ associated protein 2 (DAZAP2) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène DAZAP2 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène DAZAP2 (Bioinformatic Harvester (EMBL)) |
