Sie sind hier: Startseite » Produktdetails für "DAZ interacting protein 1 DZIP1 Human"

Produktdetails für DAZ interacting protein 1 (DZIP1) (Human) antibody

Druckversion

DAZ interacting protein 1 (DZIP1) (Human) antibody

Übersicht


	Antigen:	DAZ interacting protein 1 (DZIP1)
	Antikörper-Typ:	Polyklonal
	Applikation:	Western Blotting (WB), ELISA
	Reaktivität:	Human
	Wirt:	Mouse
	Menge:	50 µl
	Preis:	258,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt)
	Bestellnummer:	ABIN172194
	Verfügbarkeit:	Delivery in 7 to 10 days

Antigen	DAZ interacting protein 1 (DZIP1)
Gen-ID	22873
Immunogen	DZIP1 (NP_945319, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSH IEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSI *
Reaktivität	Human
Antikörper-Typ	Polyklonal
Beschreibung	DAZ interacting protein 1 Mouse polyclonal antibody raised against a partial recombinant DZIP1. Synonyms: DZIP, DZIPt1, KIAA0996, RP11-23E3.3
Wirt	Mouse

Applikation	Western Blotting (WB), ELISA
Applikationshinweise	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) .
Lagerung	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Beschränkungen	For Research Use only

Western Blot detection against Immunogen (38.21 KDa) .

Bild für DAZ interacting protein 1 (DZIP1) (Human) antibody (1)

Google Scholar	Suchen Sie in Google Scholar™ nach weiteren Artikeln für Antigen DZIP1
EMBL Harvester	Genom von Mensch, Maus oder Ratte nach Antigen DZIP1 durchsuchen (Bioinformatic Harvester (EMBL))