PANIER
AIDE
Antigènes
Détail du produit pour DAZ interacting protein 1 (DZIP1) (Human) antibody
DAZ interacting protein 1 (DZIP1) (Human) antibody
Aperçu
|
|
| Antigène: | DAZ interacting protein 1 (DZIP1) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN172194 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: DAZ interacting protein 1 (DZIP1) (Human) antibody
| Antigène | DAZ interacting protein 1 (DZIP1) |
| ID gène | 22873 |
| Immunogène | DZIP1 (NP_945319, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSH IEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSI * |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | DAZ interacting protein 1 Mouse polyclonal antibody raised against a partial recombinant DZIP1. Synonyms: DZIP, DZIPt1, KIAA0996, RP11-23E3.3 |
| Hôte | Mouse |
Applications: DAZ interacting protein 1 (DZIP1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: DAZ interacting protein 1 (DZIP1) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
Informations supplémentaires: DAZ interacting protein 1 (DZIP1) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène DZIP1 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène DZIP1 (Bioinformatic Harvester (EMBL)) |
