SHOW TUTORIAL VIDEO Show Tutorial Video
Product details for  DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) (Human) a...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) (Human) antibody

Overview

Image for DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) (Human) antibody
Antigen: DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human, Mouse (Murine), Rat
Host: Mouse
Quantity: 100 µg
Price: 538,36 $   (Plus shipping costs , $13.59 dry ice fee and VAT, Invoice in EUR)
Order number: ABIN166037
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) (Human) antibody

back to top ^


Antigen DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)
Gene ID 1659
Immunogen DHX8 (NP_004932, 301 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLV GETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW*
Reactivity Human, Mouse (Murine), Rat
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description DEAH (Asp-Glu-Ala-His) box polypeptide 8 DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is highly homologous to yeast Prp22. This protein facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. Mouse monoclonal antibody raised against a partial recombinant DHX8. Synonyms: DDX8, HRH1, PRP22, PRPF22
Clone 10000000000
Host Mouse

Application Details:  DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) (Human) antibody (1)

The detection limit for recombinant GST tagged DHX8 is approximately 0.3ng/ml as a capture antibody.

Image for DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) (Human) antibody (2)

External Information:  DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) (Human) antibody

back to top ^


Google Scholar Find more references for clone 10000000000 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen DHX8 (Bioinformatic Harvester (EMBL))