BASKET
HELP
Product details for E1A binding protein p300 (EP300) (Human) antibody
E1A binding protein p300 (EP300) (Human) antibody
Overview
|
|
| Antigen: | E1A binding protein p300 (EP300) |
| Antibody Type: | Monoclonal |
| Application: | Immunohistochemistry (IHC), Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 538,36 $ (Plus shipping costs , $13.59 dry ice fee and VAT, Invoice in EUR) |
| Order number: | ABIN166149 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: E1A binding protein p300 (EP300) (Human) antibody
| Antigen | E1A binding protein p300 (EP300) |
| Gene ID | 2033 |
| Immunogen | EP300 (NP_001420, 731 a.a. ~ 831 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPS SGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 »Matching secondary antibodies |
| Description | E1A binding protein p300 EP300 encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. p300 is related by sequence to CBP (CREB-binding protein [CREB: cyclic-AMP responsive element binding protein]), and like CBP can stimulate transcription through activation of CREB. This EP300 activity is specifically inhibited by the adenovirus oncoprotein E1A. EP300 has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Mouse monoclonal antibody raised against a partial recombinant EP300. Synonyms: p300 |
| Clone | 1B1 |
| Host | Mouse |
Application Details: E1A binding protein p300 (EP300) (Human) antibody
| Application | Immunohistochemistry (IHC), Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: E1A binding protein p300 (EP300) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) .
Immunoperoxidase of monoclonal antibody to EP300 (H00002033-M01) on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
