PANIER
AIDE
Antigènes
Détail du produit pour F-box protein 16 (FBXO16) (Human) antibody
F-box protein 16 (FBXO16) (Human) antibody
Aperçu
|
|
| Antigène: | F-box protein 16 (FBXO16) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN173180 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: F-box protein 16 (FBXO16) (Human) antibody
| Antigène | F-box protein 16 (FBXO16) |
| ID gène | 157574 |
| Immunogène | FBXO16 (NP_758954, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRR RILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYI* |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | F-box protein 16 This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. Mouse polyclonal antibody raised against a partial recombinant FBXO16. Synonyms: FBX16, MGC125923, MGC125924, MGC125925 |
| Hôte | Mouse |
Applications: F-box protein 16 (FBXO16) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: F-box protein 16 (FBXO16) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
Informations supplémentaires: F-box protein 16 (FBXO16) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène FBXO16 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène FBXO16 (Bioinformatic Harvester (EMBL)) |
