Produktdetails für F-box protein 46 (FBXO46) (Human) antibody
F-box protein 46 (FBXO46) (Human) antibody
Übersicht
|
|
| Antigen: | F-box protein 46 (FBXO46) |
| Antikörper-Typ: | Polyklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 258,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN172257 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: F-box protein 46 (FBXO46) (Human) antibody
| Antigen | F-box protein 46 (FBXO46) |
| Gen-ID | 23403 |
| Immunogen | FBXO46 (XP_371179, 176 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VALVEQRAALALQSYPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEA VAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNGREPRAPD* |
| Reaktivität | Human |
| Antikörper-Typ | Polyklonal |
| Beschreibung | F-box protein 46 Members of the F-box protein family, such as FBXO46, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1, MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004). Mouse polyclonal antibody raised against a partial recombinant FBXO46. Synonyms: 20D7-FC4, FBXO34L, Fbx46 |
| Wirt | Mouse |
Anwendungen: F-box protein 46 (FBXO46) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: F-box protein 46 (FBXO46) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
Weitere Informationen: F-box protein 46 (FBXO46) (Human) antibody
| Google Scholar | Suchen Sie in Google Scholar™ nach weiteren Artikeln für Antigen FBXO46 |
| EMBL Harvester | Genom von Mensch, Maus oder Ratte nach Antigen FBXO46 durchsuchen (Bioinformatic Harvester (EMBL)) |








