PANIER
AIDE
Antigènes
Détail du produit pour G protein-coupled receptor 89 (GPR89) (Human) antibody
G protein-coupled receptor 89 (GPR89) (Human) antibody
Aperçu
|
|
| Antigène: | G protein-coupled receptor 89 (GPR89) |
| Type anticorps: | Monoclonal |
| Application: | ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 396,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN168939 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: G protein-coupled receptor 89 (GPR89) (Human) antibody
| Antigène | G protein-coupled receptor 89 (GPR89) |
| ID gène | 51463 |
| Immunogène | GPR89 (AAH03187, 175 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWG MIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK * |
| Reactivité | Human |
| Type anticorps | Monoclonal |
| Isotype | IgG2b Kappa »Anticorps secondaires correspondants |
| Description | G protein-coupled receptor 89 Mouse monoclonal antibody raised against a partial recombinant GPR89. Synonyms: AL844549.1, SH120 |
| Clone | 4D8 |
| Hôte | Mouse |
Applications: G protein-coupled receptor 89 (GPR89) (Human) antibody
| Application | ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein on ELISA |
| Buffer | In 1x PBS, pH 7.2 |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: G protein-coupled receptor 89 (GPR89) (Human) antibody
|
The detection limit for recombinant GST tagged GPR89 is approximately 1ng/ml as a capture antibody. |
