Product details for  ISL1 transcription factor, LIM/homeodomain, (islet-1) (IS...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

ISL1 transcription factor, LIM/homeodomain, (islet-1) (ISL1) (Human) antibody

Overview

Image for ISL1 transcription factor, LIM/homeodomain, (islet-1) (ISL1) (Human) antibody
Antigen: ISL1 transcription factor, LIM/homeodomain, (islet-1) (ISL1)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN166653
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  ISL1 transcription factor, LIM/homeodomain, (islet-1) (ISL1) (Human) antibody

back to top ^


Antigen ISL1 transcription factor, LIM/homeodomain, (islet-1) (ISL1)
Gene ID 3670
Immunogen ISL1 (NP_002193, 63 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) YCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEF ALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEP*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description ISL1 transcription factor, LIM/homeodomain, (islet-1) This gene encodes a transcription factor containing two N-terminal LIM domains and one C-terminal homeodomain. The encoded protein plays an important role in the embryogenesis of pancreatic islets of Langerhans. In mouse embryos, a deficiency of this gene fail to undergo neural tube motor neuron differentiation. Mouse monoclonal antibody raised against a partial recombinant ISL1. Synonyms: Isl-1
Clone 8A3
Host Mouse

Application Details:  ISL1 transcription factor, LIM/homeodomain, (islet-1) (ISL1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.78 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  ISL1 transcription factor, LIM/homeodomain, (islet-1) (ISL1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.78 KDa) .

Image for ISL1 transcription factor, LIM/homeodomain, (islet-1) (ISL1) (Human) antibody (1)

External Information:  ISL1 transcription factor, LIM/homeodomain, (islet-1) (ISL1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 8A3 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ISL1 (Bioinformatic Harvester (EMBL))