Product details for Kallmann syndrome 1 sequence (KAL1) (Human) antibody
Kallmann syndrome 1 sequence (KAL1) (Human) antibody
Overview
|
|
| Antigen: | Kallmann syndrome 1 sequence (KAL1) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN166671 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: Kallmann syndrome 1 sequence (KAL1) (Human) antibody
| Antigen | Kallmann syndrome 1 sequence (KAL1) |
| Gene ID | 3730 |
| Immunogen | KAL1 (NP_000207, 548 a.a. ~ 658 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESRQNSLP NSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRTPELPP * |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | Kallmann syndrome 1 sequence Mutations in the KAL1 gene cause the X-linked Kallmann syndrome. The predictated KAL1 protein sequence is similar to proteins known to function in neural cell adhesion and axonal migration. Mouse monoclonal antibody raised against a partial recombinant KAL1. Synonyms: ADMLX, HHA, KAL, KALIG-1, KMS |
| Clone | 200000000 |
| Host | Mouse |
Application Details: Kallmann syndrome 1 sequence (KAL1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: Kallmann syndrome 1 sequence (KAL1) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
External Information: Kallmann syndrome 1 sequence (KAL1) (Human) antibody
| Google Scholar | Find more references for clone 200000000 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen KAL1 (Bioinformatic Harvester (EMBL)) |








