Produktdetails für M-phase phosphoprotein 1 (MPHOSPH1) (Human) antibody
M-phase phosphoprotein 1 (MPHOSPH1) (Human) antibody
Übersicht
|
|
| Antigen: | M-phase phosphoprotein 1 (MPHOSPH1) |
| Antikörper-Typ: | Polyklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 258,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN171786 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: M-phase phosphoprotein 1 (MPHOSPH1) (Human) antibody
| Antigen | M-phase phosphoprotein 1 (MPHOSPH1) |
| Gen-ID | 9585 |
| Immunogen | MPHOSPH1 (NP_057279, 1671 a.a. ~ 1781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RSQASIIGVNLATKKKEGTLQKFGDFLQHSPSILQSKAKKIIETMSSSKLSNVEA SKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQKMKESDHQIIKRRLRTKTAK * |
| Reaktivität | Human |
| Antikörper-Typ | Polyklonal |
| Beschreibung | M-phase phosphoprotein 1 Mouse polyclonal antibody raised against a partial recombinant MPHOSPH1. Synonyms: DKFZp434B0435, DKFZp434P0810, KRMP1, MPP-1, MPP1 |
| Wirt | Mouse |
Anwendungen: M-phase phosphoprotein 1 (MPHOSPH1) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: M-phase phosphoprotein 1 (MPHOSPH1) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
Weitere Informationen: M-phase phosphoprotein 1 (MPHOSPH1) (Human) antibody
| Google Scholar | Suchen Sie in Google Scholar™ nach weiteren Artikeln für Antigen MPHOSPH1 |
| EMBL Harvester | Genom von Mensch, Maus oder Ratte nach Antigen MPHOSPH1 durchsuchen (Bioinformatic Harvester (EMBL)) |








