PANIER
AIDE
Antigènes
Détail du produit pour M-phase phosphoprotein 9 (MPHOSPH9) (Human) antibody
M-phase phosphoprotein 9 (MPHOSPH9) (Human) antibody
Aperçu
|
|
| Antigène: | M-phase phosphoprotein 9 (MPHOSPH9) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN171911 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: M-phase phosphoprotein 9 (MPHOSPH9) (Human) antibody
| Antigène | M-phase phosphoprotein 9 (MPHOSPH9) |
| ID gène | 10198 |
| Immunogène | MPHOSPH9 (NP_073619, 922 a.a. ~ 1032 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQI EAALSRMPSPGGRITLQTRLNQEALEDRLERINRELGSVRMTLKKFHVLRTSANL * |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | M-phase phosphoprotein 9 Mouse polyclonal antibody raised against a partial recombinant MPHOSPH9. Synonyms: DKFZp434J034, FLJ12954, MPP-9, MPP9 |
| Hôte | Mouse |
Applications: M-phase phosphoprotein 9 (MPHOSPH9) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: M-phase phosphoprotein 9 (MPHOSPH9) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
Informations supplémentaires: M-phase phosphoprotein 9 (MPHOSPH9) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène MPHOSPH9 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène MPHOSPH9 (Bioinformatic Harvester (EMBL)) |
