PANIER
AIDE
Antigènes
Détail du produit pour NACHT, leucine rich repeat and PYD containing 12 (NALP12)...
NACHT, leucine rich repeat and PYD containing 12 (NALP12) (Human) antibody
Aperçu
|
|
| Antigène: | NACHT, leucine rich repeat and PYD containing 12 (NALP12) |
| Type anticorps: | Monoclonal |
| Application: | ELISA, Western Blotting (WB) |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 396,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN169494 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: NACHT, leucine rich repeat and PYD containing 12 (NALP12) (Human) antibody
| Antigène | NACHT, leucine rich repeat and PYD containing 12 (NALP12) |
| ID gène | 91662 |
| Immunogène | NALP12 (AAH28069, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGKIPWGSMEKAGPLE MAQLLITHFGPEEAWRLALSTFERINRKDLWERGQREDLVRDTPPGGPSSLGNQS |
| Reactivité | Human |
| Type anticorps | Monoclonal |
| Isotype | IgG2a Kappa »Anticorps secondaires correspondants |
| Description | NACHT, leucine rich repeat and PYD containing 12 NALPs are cytoplasmic proteins that form a subfamily within the larger CATERPILLER protein family. Most short NALPs, such as NALP12, have an N-terminal pyrin (MEFV, MIM 608107) domain (PYD), followed by a NACHT domain, a NACHT-associated domain (NAD), and a C-terminal leucine-rich repeat (LRR) region. The long NALP, NALP1 (MIM 606636), also has a C-terminal extension containing a function to find domain (FIIND) and a caspase recruitment domain (CARD). NALPs are implicated in the activation of proinflammatory caspases (e.g., CASP1, MIM 147678) via their involvement in multiprotein complexes called inflammasomes (Tschopp et al., 2003). Mouse monoclonal antibody raised against a partial recombinant NALP12. Synonyms: PYPAF7, RNO2 |
| Clone | 3B5 |
| Hôte | Mouse |
Applications: NACHT, leucine rich repeat and PYD containing 12 (NALP12) (Human) antibody
| Application | ELISA, Western Blotting (WB) |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (35.10 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: NACHT, leucine rich repeat and PYD containing 12 (NALP12) (Human) antibody
|
Western Blot detection against Immunogen (35.10 KDa) .
The detection limit for recombinant GST tagged NALP12 is approximately 0.3ng/ml as a capture antibody. |
Informations supplémentaires: NACHT, leucine rich repeat and PYD containing 12 (NALP12) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour clone 3B5 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène NALP12 (Bioinformatic Harvester (EMBL)) |
