Product details for  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9) (Human) antibody

Overview

Image for NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9) (Human) antibody
Antigen: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9)
Antibody Type: Monoclonal
Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Reactivity: Human, Mouse (Murine), Rat
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN166891
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9) (Human) antibody

back to top ^


Antigen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9)
Gene ID 4704
Immunogen NDUFA9 (NP_004993, 303 a.a. ~ 378 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHR TYRWLSAEIEDVKPAKTVNI*
Reactivity Human, Mouse (Murine), Rat
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa Mouse monoclonal antibody raised against a partial recombinant NDUFA9. Synonyms: MGC111043, NDUFS2L
Clone 3D7
Host Mouse

Application Details:  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9) (Human) antibody

back to top ^


Application Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (34.36 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9) (Human) antibody

back to top ^


Western Blot detection against Immunogen (34.36 KDa) .

Image for NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to NDUFA9 (H00004704-M01) on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.8 ug/ml]

Image for NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9) (Human) antibody (2)

The detection limit for recombinant GST tagged NDUFA9 is approximately 0.1ng/ml as a capture antibody.

Image for NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9) (Human) antibody (3)

External Information:  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa (NDUFA9) (Human) antibody

back to top ^


Google Scholar Find more references for clone 3D7 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NDUFA9 (Bioinformatic Harvester (EMBL))