PANIER
AIDE
Antigènes
Détail du produit pour N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucos...
N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody
Aperçu
|
|
| Antigène: | N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN172498 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody
| Antigène | N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) |
| ID gène | 51172 |
| Immunogène | NAGPA (NP_057340, 309 a.a. ~ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPGCDELDCG PSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKC* |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase Hydrolases are transported to lysosomes after binding to mannose 6-phosphate receptors in the trans-Golgi network. This gene encodes the enzyme that catalyzes the second step in the formation of the mannose 6-phosphate recognition marker on lysosomal hydrolases. Commonly known as 'uncovering enzyme' or UCE, this enzyme removes N-acetyl-D-glucosamine (GlcNAc) residues from GlcNAc-alpha-P-mannose moieties and thereby produces the recognition marker. This reaction most likely occurs in the trans-Golgi network. This enzyme functions as a homotetramer of two disulfide-linked homodimers. In addition to having an N-terminal signal peptide, the protein's C-terminus contains multiple signals for trafficking it between lysosomes, the plasma membrane, and trans-Golgi network. Mouse polyclonal antibody raised against a partial recombinant NAGPA. Synonyms: APAA, UCE |
| Hôte | Mouse |
Applications: N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
Informations supplémentaires: N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène NAGPA sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène NAGPA (Bioinformatic Harvester (EMBL)) |
