Produktdetails für N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB)...
N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
Übersicht
|
|
| Antigen: | N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) |
| Antikörper-Typ: | Polyklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 258,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN170699 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
| Antigen | N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) |
| Gen-ID | 4669 |
| Immunogen | NAGLU (NP_000254, 644 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) YQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFD KNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGS* |
| Reaktivität | Human |
| Antikörper-Typ | Polyklonal |
| Beschreibung | N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) This gene encodes an enzyme that degrades heparan sulfate by hydrolysis of terminal N-acetyl-D-glucosamine residues in N-acetyl-alpha-D-glucosaminides. Defects in this gene are the cause of mucopolysaccharidosis type IIIB (MPS-IIIB), also known as Sanfilippo syndrome B. This disease is characterized by the lysosomal accumulation and urinary excretion of heparan sulfate. Mouse polyclonal antibody raised against a partial recombinant NAGLU. Synonyms: NAG, UFHSD |
| Wirt | Mouse |
Anwendungen: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
|
Western Blot detection against Immunogen (37.00 KDa) . |
Weitere Informationen: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
| Google Scholar | Suchen Sie in Google Scholar™ nach weiteren Artikeln für Antigen NAGLU |
| EMBL Harvester | Genom von Mensch, Maus oder Ratte nach Antigen NAGLU durchsuchen (Bioinformatic Harvester (EMBL)) |








