PANIER
AIDE
Antigènes
Détail du produit pour N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB)...
N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
Aperçu
|
|
| Antigène: | N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN170699 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
| Antigène | N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) |
| ID gène | 4669 |
| Immunogène | NAGLU (NP_000254, 644 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) YQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFD KNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGS* |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) This gene encodes an enzyme that degrades heparan sulfate by hydrolysis of terminal N-acetyl-D-glucosamine residues in N-acetyl-alpha-D-glucosaminides. Defects in this gene are the cause of mucopolysaccharidosis type IIIB (MPS-IIIB), also known as Sanfilippo syndrome B. This disease is characterized by the lysosomal accumulation and urinary excretion of heparan sulfate. Mouse polyclonal antibody raised against a partial recombinant NAGLU. Synonyms: NAG, UFHSD |
| Hôte | Mouse |
Applications: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
|
Western Blot detection against Immunogen (37.00 KDa) . |
Informations supplémentaires: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène NAGLU sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène NAGLU (Bioinformatic Harvester (EMBL)) |
