Product details for  N-acetyltransferase 2 (arylamine N-acetyltransferase) (NA...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2) (Human) antibody

Overview

Image for N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2) (Human) antibody
Antigen: N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN165531
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2) (Human) antibody

back to top ^


Antigen N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2)
Gene ID 10
Immunogen NAT2 (AAH15878, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIF CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLE
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description N-acetyltransferase 2 (arylamine N-acetyltransferase) This gene encodes N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near NAT2. Mouse monoclonal antibody raised against a partial recombinant NAT2. Synonyms: AAC2
Clone 3B5
Host Mouse

Application Details:  N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (34.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2) (Human) antibody

back to top ^


Western Blot detection against Immunogen (34.00 KDa) .

Image for N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2) (Human) antibody (1)

External Information:  N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2) (Human) antibody

back to top ^


Google Scholar Find more references for clone 3B5 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NAT2 (Bioinformatic Harvester (EMBL))