Produktdetails für N-acylsphingosine amidohydrolase (acid ceramidase)-like (...
N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
Übersicht
|
|
| Antigen: | N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) |
| Antikörper-Typ: | Monoklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human, Mouse (Murine), Rat |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 396,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN168780 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
| Antigen | N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) |
| Gen-ID | 27163 |
| Immunogen | ASAHL (NP_055250, 36 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERF LPQPFTGEIRGMCD* |
| Reaktivität | Human, Mouse (Murine), Rat |
| Antikörper-Typ | Monoklonal |
| Isotyp | IgG2a Kappa »Passende Sekundärantikörper |
| Beschreibung | N-acylsphingosine amidohydrolase (acid ceramidase)-like This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene. Mouse monoclonal antibody raised against a partial recombinant ASAHL. Synonyms: NAAA |
| Klon | 5000 |
| Wirt | Mouse |
Anwendungen: N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (33.70 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
|
Western Blot detection against Immunogen (33.70 KDa) .
The detection limit for recombinant GST tagged ASAHL is approximately 0.3ng/ml as a capture antibody. |








