Produktdetails für N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3...
N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
Übersicht
|
|
| Antigen: | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) |
| Antikörper-Typ: | Monoklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 396,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN168070 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
| Antigen | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) |
| Gen-ID | 9348 |
| Immunogen | NDST3 (NP_004775, 162 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLP GTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH* |
| Reaktivität | Human |
| Antikörper-Typ | Monoklonal |
| Isotyp | IgG2a Kappa »Passende Sekundärantikörper |
| Beschreibung | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 Mouse monoclonal antibody raised against a partial recombinant NDST3. Synonyms: MGC130028, MGC130029 |
| Klon | 5B9 |
| Wirt | Mouse |
Anwendungen: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.89 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
|
Western Blot detection against Immunogen (36.89 KDa) .
The detection limit for recombinant GST tagged NDST3 is approximately 1ng/ml as a capture antibody. |








