PANIER
AIDE
Antigènes
Détail du produit pour N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3...
N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
Aperçu
|
|
| Antigène: | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) |
| Type anticorps: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 396,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN168070 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
| Antigène | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) |
| ID gène | 9348 |
| Immunogène | NDST3 (NP_004775, 162 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLP GTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH* |
| Reactivité | Human |
| Type anticorps | Monoclonal |
| Isotype | IgG2a Kappa »Anticorps secondaires correspondants |
| Description | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 Mouse monoclonal antibody raised against a partial recombinant NDST3. Synonyms: MGC130028, MGC130029 |
| Clone | 5B9 |
| Hôte | Mouse |
Applications: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.89 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
|
Western Blot detection against Immunogen (36.89 KDa) .
The detection limit for recombinant GST tagged NDST3 is approximately 1ng/ml as a capture antibody. |
Informations supplémentaires: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour clone 5B9 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène NDST3 (Bioinformatic Harvester (EMBL)) |
