Additional Information: N-methylpurine-DNA glycosylase (MPG) (Human) antibody

Antigen	N-methylpurine-DNA glycosylase (MPG)
Gene ID	4350
Immunogen	MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRER CLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG2a Kappa »Matching secondary antibodies
Description	N-methylpurine-DNA glycosylase Mouse monoclonal antibody raised against a partial recombinant MPG. Synonyms: AAG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16, anpg
Clone	10000000000
Host	Mouse

Application Details: N-methylpurine-DNA glycosylase (MPG) (Human) antibody

Application	Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (32.90 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (32.90 KDa) .

Image for N-methylpurine-DNA glycosylase (MPG) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to MPG (H00004350-M04) on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

Image for N-methylpurine-DNA glycosylase (MPG) (Human) antibody (2)

The detection limit for recombinant GST tagged MPG is approximately 0.03ng/ml as a capture antibody.

Image for N-methylpurine-DNA glycosylase (MPG) (Human) antibody (3)

more...

Google Scholar	Find more references for clone 10000000000 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen MPG (Bioinformatic Harvester (EMBL))


	Antigen:	N-methylpurine-DNA glycosylase (MPG)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), Immunohistochemistry (IHC), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN166833
	Availability:	Delivery in 7 to 10 days