Product details for N-methylpurine-DNA glycosylase (MPG) (Human) antibody
N-methylpurine-DNA glycosylase (MPG) (Human) antibody
Overview
|
|
| Antigen: | N-methylpurine-DNA glycosylase (MPG) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN166834 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: N-methylpurine-DNA glycosylase (MPG) (Human) antibody
| Antigen | N-methylpurine-DNA glycosylase (MPG) |
| Gene ID | 4350 |
| Immunogen | MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRER CLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | N-methylpurine-DNA glycosylase Mouse monoclonal antibody raised against a partial recombinant MPG. Synonyms: AAG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16, anpg |
| Clone | 2D2 |
| Host | Mouse |
Application Details: N-methylpurine-DNA glycosylase (MPG) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (32.90 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: N-methylpurine-DNA glycosylase (MPG) (Human) antibody
|
Western Blot detection against Immunogen (32.90 KDa) .
The detection limit for recombinant GST tagged MPG is approximately 0.03ng/ml as a capture antibody. |








