BASKET
HELP
Product details for RNA-binding region (RNP1, RRM) containing 2 (RNPC2) (Huma...
RNA-binding region (RNP1, RRM) containing 2 (RNPC2) (Human) antibody
Overview
|
|
| Antigen: | RNA-binding region (RNP1, RRM) containing 2 (RNPC2) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Reactivity: | Human, Mouse (Murine), Rat |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN168124 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: RNA-binding region (RNP1, RRM) containing 2 (RNPC2) (Human) antibody
| Antigen | RNA-binding region (RNP1, RRM) containing 2 (RNPC2) |
| Gene ID | 9584 |
| Immunogen | RNPC2 (NP_909122, 423 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG* |
| Reactivity | Human, Mouse (Murine), Rat |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | RNA-binding region (RNP1, RRM) containing 2 The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. Mouse monoclonal antibody raised against a partial recombinant RNPC2. Synonyms: CAPER, CC1.3, CC1.4, DKFZp781C0423, HCC1, RBM39 |
| Clone | 4G8 |
| Host | Mouse |
Application Details: RNA-binding region (RNP1, RRM) containing 2 (RNPC2) (Human) antibody
| Application | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (35.13 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: RNA-binding region (RNP1, RRM) containing 2 (RNPC2) (Human) antibody
|
Western Blot detection against Immunogen (35.13 KDa) .
Immunoperoxidase of monoclonal antibody to RNPC2 (H00009584-M01) on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml]
The detection limit for recombinant GST tagged RNPC2 is approximately 0.03ng/ml as a capture antibody. |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
