You are here: Homepage » Product details for "SCAN domain containing 2 SCAND2 Human"

Product details for SCAN domain containing 2 (SCAND2) (Human) antibody

Print Version

SCAN domain containing 2 (SCAND2) (Human) antibody

Overview


	Antigen:	SCAN domain containing 2 (SCAND2)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN169012
	Availability:	Delivery in 7 to 10 days

Antigen	SCAN domain containing 2 (SCAND2)
Gene ID	54581
Immunogen	SCAND2 (NP_071333, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQE ASRPREA*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG1 Kappa »Matching secondary antibodies
Description	SCAN domain containing 2 The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity. Multiple transcript variants which encode the same isoform but differ only in their 3' UTRs, and another variant which encodes a distinct isoform have been described for this gene. Mouse monoclonal antibody raised against a partial recombinant SCAND2.
Clone	5F1
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (32.56 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (32.56 KDa) .

Image for SCAN domain containing 2 (SCAND2) (Human) antibody (1)

Google Scholar	Find more references for clone 5F1 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen SCAND2 (Bioinformatic Harvester (EMBL))