Product details for SHC (Src homology 2 domain containing) transforming prote...
SHC (Src homology 2 domain containing) transforming protein 1 (SHC1) (Human) antibody
Overview
|
|
| Antigen: | SHC (Src homology 2 domain containing) transforming protein 1 (SHC1) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN167416 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: SHC (Src homology 2 domain containing) transforming protein 1 (SHC1) (Human) antibody
| Antigen | SHC (Src homology 2 domain containing) transforming protein 1 (SHC1) |
| Gene ID | 6464 |
| Immunogen | SHC1 (AAH33925, 171 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQA VGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLS |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG Mix Kappa »Matching secondary antibodies |
| Description | SHC (Src homology 2 domain containing) transforming protein 1 Mouse monoclonal antibody raised against a partial recombinant SHC1. Synonyms: FLJ26504, SHC, SHCA, p52SHC, p66SHC |
| Clone | 3F4 |
| Host | Mouse |
Application Details: SHC (Src homology 2 domain containing) transforming protein 1 (SHC1) (Human) antibody
| Application | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (35.10 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: SHC (Src homology 2 domain containing) transforming protein 1 (SHC1) (Human) antibody
|
Western Blot detection against Immunogen (35.10 KDa) .
Immunoperoxidase of monoclonal antibody to SHC1 (H00006464-M01) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]
The detection limit for SHC1 is approximately 0.03ng/ml as a capture antibody. |








