BASKET
HELP
Product details for SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) ...
SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) (Human) antibody
Overview
|
|
| Antigen: | SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN166748 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) (Human) antibody
| Antigen | SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) |
| Gene ID | 4086 |
| Immunogen | SMAD1 (NP_005891, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKAL SCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCE * |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 kappa »Matching secondary antibodies |
| Description | SMAD, mothers against DPP homolog 1 (Drosophila) The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. Mouse monoclonal antibody raised against a partial recombinant SMAD1. Synonyms: BSP1, JV4-1, JV41, MADH1, MADR1 |
| Clone | 1D3 |
| Host | Mouse |
Application Details: SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) (Human) antibody
| Application | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) .
Immunoperoxidase of monoclonal antibody to SMAD1 (H00004086-M02) on formalin-fixed paraffin-embedded human salivary gland tissue. [antibody concentration 3ug/ml]
The detection limit for recombinant GST tagged SMAD1 is approximately 3ng/ml as a capture antibody. |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
