PANIER
AIDE
Antigènes
Détail du produit pour SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) ...
SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) (Human) antibody
Aperçu
|
|
| Antigène: | SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 63,90 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN197771 |
| Disponibilité: | Ships within 1 day |
Description du produit: SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) (Human) antibody
| Antigène | SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) |
| ID gène | 4086 |
| Immunogène | SMAD1 (NP_005891, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKAL SCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCE * |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | SMAD, mothers against DPP homolog 1 (Drosophila) The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. Mouse polyclonal antibody raised against a partial recombinant SMAD1. Synonyms: BSP1, JV4-1, JV41, MADH1, MADR1 |
| Hôte | Mouse |
Applications: SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Stock | Store at -20 |
| Restrictions | For Research Use only |
Images: SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
Alternatives
Informations supplémentaires: SMAD, mothers against DPP homolog 1 (Drosophila) (SMAD1) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène SMAD1 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène SMAD1 (Bioinformatic Harvester (EMBL)) |
