WARENKORB
HILFE
Produktdetails für a disintegrin and metalloproteinase domain 17 (tumor necr...
a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme) (ADAM17) (Human) antibody
Übersicht
|
|
| Antigen: | A disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme) (ADAM17) |
| Antikörper-Typ: | Monoklonal |
| Applikation: | Immunohistochemistry (IHC), ELISA, Western Blotting (WB) |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 396,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN167544 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme) (ADAM17) (Human) antibody
| Antigen | A disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme) (ADAM17) |
| Gen-ID | 6868 |
| Immunogen | ADAM17 (NP_003174, 215 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDN AGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV* |
| Reaktivität | Human |
| Antikörper-Typ | Monoklonal |
| Isotyp | IgG2b Kappa »Passende Sekundärantikörper |
| Beschreibung | ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme, binds mitotic arrest deficient 2 protein, and also plays a prominent role in the activation of the Notch signaling pathway. Mouse monoclonal antibody raised against a partial recombinant ADAM17. Synonyms: CD156b, MGC71942, TACE, cSVP |
| Klon | 1F6 |
| Wirt | Mouse |
Anwendungen: a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme) (ADAM17) (Human) antibody
| Applikation | Immunohistochemistry (IHC), ELISA, Western Blotting (WB) |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme) (ADAM17) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) .
Immunoperoxidase of monoclonal antibody to ADAM17 (H00006868-M01) on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
The detection limit for recombinant GST tagged ADAM17 is approximately 3ng/ml as a capture antibody. |
Weitere Informationen: a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme) (ADAM17) (Human) antibody
| Google Scholar | Suchen Sie in Google Scholar™ nach weiteren Artikeln für Klon 1F6 |
| EMBL Harvester | Genom von Mensch, Maus oder Ratte nach Antigen ADAM17 durchsuchen (Bioinformatic Harvester (EMBL)) |
Einstieg in Antikörper-Suche nach:
Antigene
Sekundärantikörper
Forschungsgebiete
Klone
Wirte
Applikationen
Reaktivität
Anbieter
Antigene
Sekundärantikörper
Forschungsgebiete
Klone
Wirte
Applikationen
Reaktivität
Anbieter
