Product details for  a disintegrin and metalloproteinase domain 2 (fertilin be...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

a disintegrin and metalloproteinase domain 2 (fertilin beta) (ADAM2) (Human) antibody

Overview

Image for a disintegrin and metalloproteinase domain 2 (fertilin beta) (ADAM2) (Human) antibody
Antigen: A disintegrin and metalloproteinase domain 2 (fertilin beta) (ADAM2)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl (Product variants)
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170266
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  a disintegrin and metalloproteinase domain 2 (fertilin beta) (ADAM2) (Human) antibody

back to top ^


Antigen A disintegrin and metalloproteinase domain 2 (fertilin beta) (ADAM2)
Gene ID 2515
Immunogen ADAM2 (NP_001455, 376 a.a. ~ 476 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEG PCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH*
Reactivity Human
Antibody Type Polyclonal
Description ADAM metallopeptidase domain 2 (fertilin beta) This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. Mouse polyclonal antibody raised against a partial recombinant ADAM2. Synonyms: CRYN1, CRYN2, FTNB, PH-30b, PH30
Host Mouse

Application Details:  a disintegrin and metalloproteinase domain 2 (fertilin beta) (ADAM2) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  a disintegrin and metalloproteinase domain 2 (fertilin beta) (ADAM2) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for a disintegrin and metalloproteinase domain 2 (fertilin beta) (ADAM2) (Human) antibody (1)

External Information:  a disintegrin and metalloproteinase domain 2 (fertilin beta) (ADAM2) (Human) antibody

back to top ^


Google Scholar Find more references for antigen ADAM2 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ADAM2 (Bioinformatic Harvester (EMBL))