Produktdetails für a disintegrin and metalloproteinase domain 33 (ADAM33) (H...
a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
Übersicht
|
|
| Antigen: | A disintegrin and metalloproteinase domain 33 (ADAM33) |
| Antikörper-Typ: | Polyklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 258,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN172946 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
| Antigen | A disintegrin and metalloproteinase domain 33 (ADAM33) |
| Gen-ID | 80332 |
| Immunogen | ADAM33 (NP_079496, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVT CRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQEL* |
| Reaktivität | Human |
| Antikörper-Typ | Polyklonal |
| Beschreibung | ADAM metallopeptidase domain 33 This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Mouse polyclonal antibody raised against a partial recombinant ADAM33. Synonyms: DJ964F7.1, DKFZp434K0521, FLJ35308, FLJ36751, MGC71889 |
| Wirt | Mouse |
Anwendungen: a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
Weitere Informationen: a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
| Google Scholar | Suchen Sie in Google Scholar™ nach weiteren Artikeln für Antigen ADAM33 |
| EMBL Harvester | Genom von Mensch, Maus oder Ratte nach Antigen ADAM33 durchsuchen (Bioinformatic Harvester (EMBL)) |








