PANIER
AIDE
Antigènes
Détail du produit pour a disintegrin and metalloproteinase domain 33 (ADAM33) (H...
a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
Aperçu
|
|
| Antigène: | A disintegrin and metalloproteinase domain 33 (ADAM33) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN172946 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
| Antigène | A disintegrin and metalloproteinase domain 33 (ADAM33) |
| ID gène | 80332 |
| Immunogène | ADAM33 (NP_079496, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVT CRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQEL* |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | ADAM metallopeptidase domain 33 This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Mouse polyclonal antibody raised against a partial recombinant ADAM33. Synonyms: DJ964F7.1, DKFZp434K0521, FLJ35308, FLJ36751, MGC71889 |
| Hôte | Mouse |
Applications: a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
Informations supplémentaires: a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène ADAM33 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène ADAM33 (Bioinformatic Harvester (EMBL)) |
