WARENKORB
HILFE
Produktdetails für a disintegrin-like and metalloprotease (reprolysin type) ...
a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
Übersicht
|
|
| Antigen: | A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) |
| Antikörper-Typ: | Monoklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 396,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN168108 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
| Antigen | A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) |
| Gen-ID | 9510 |
| Immunogen | ADAMTS1 (AAH36515, 858 a.a. ~ 968 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) WVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCPQW QLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS * |
| Reaktivität | Human |
| Antikörper-Typ | Monoklonal |
| Isotyp | IgG1 Kappa »Passende Sekundärantikörper |
| Beschreibung | ADAM metallopeptidase with thrombospondin type 1 motif, 1 This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function. Mouse monoclonal antibody raised against a partial recombinant ADAMTS1. Synonyms: C3-C5, KIAA1346, METH1 |
| Klon | 2A9 |
| Wirt | Mouse |
Anwendungen: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
Weitere Informationen: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
| Google Scholar | Suchen Sie in Google Scholar™ nach weiteren Artikeln für Klon 2A9 |
| EMBL Harvester | Genom von Mensch, Maus oder Ratte nach Antigen ADAMTS1 durchsuchen (Bioinformatic Harvester (EMBL)) |
Einstieg in Antikörper-Suche nach:
Antigene
Sekundärantikörper
Forschungsgebiete
Klone
Wirte
Applikationen
Reaktivität
Anbieter
Antigene
Sekundärantikörper
Forschungsgebiete
Klone
Wirte
Applikationen
Reaktivität
Anbieter
