PANIER
AIDE
Antigènes
Détail du produit pour a disintegrin-like and metalloprotease (reprolysin type) ...
a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
Aperçu
|
|
| Antigène: | A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) |
| Type anticorps: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 396,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN168108 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
| Antigène | A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) |
| ID gène | 9510 |
| Immunogène | ADAMTS1 (AAH36515, 858 a.a. ~ 968 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) WVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCPQW QLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS * |
| Reactivité | Human |
| Type anticorps | Monoclonal |
| Isotype | IgG1 Kappa »Anticorps secondaires correspondants |
| Description | ADAM metallopeptidase with thrombospondin type 1 motif, 1 This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function. Mouse monoclonal antibody raised against a partial recombinant ADAMTS1. Synonyms: C3-C5, KIAA1346, METH1 |
| Clone | 2A9 |
| Hôte | Mouse |
Applications: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
Informations supplémentaires: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 (ADAMTS1) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour clone 2A9 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène ADAMTS1 (Bioinformatic Harvester (EMBL)) |
