WARENKORB
HILFE
Produktdetails für a disintegrin-like and metalloprotease (reprolysin type) ...
a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
Übersicht
|
|
| Antigen: | A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) |
| Antikörper-Typ: | Polyklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 258,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN172123 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
| Antigen | A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) |
| Gen-ID | 11093 |
| Immunogen | ADAMTS13 (NP_620594, 1328 a.a. ~ 1428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESE SSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT* |
| Reaktivität | Human |
| Antikörper-Typ | Polyklonal |
| Beschreibung | ADAM metallopeptidase with thrombospondin type 1 motif, 13 This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates at least four transcript variants encoding different isoforms. Mouse polyclonal antibody raised against a partial recombinant ADAMTS13. Synonyms: C9orf8, DKFZp434C2322, MGC118899, MGC118900, TTP, VWFCP, vWF-CP |
| Wirt | Mouse |
Anwendungen: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
Weitere Informationen: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
| Google Scholar | Suchen Sie in Google Scholar™ nach weiteren Artikeln für Antigen ADAMTS13 |
| EMBL Harvester | Genom von Mensch, Maus oder Ratte nach Antigen ADAMTS13 durchsuchen (Bioinformatic Harvester (EMBL)) |
Einstieg in Antikörper-Suche nach:
Antigene
Sekundärantikörper
Forschungsgebiete
Klone
Wirte
Applikationen
Reaktivität
Anbieter
Antigene
Sekundärantikörper
Forschungsgebiete
Klone
Wirte
Applikationen
Reaktivität
Anbieter
