PANIER
AIDE
Antigènes
Détail du produit pour a disintegrin-like and metalloprotease (reprolysin type) ...
a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
Aperçu
|
|
| Antigène: | A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN172123 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
| Antigène | A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) |
| ID gène | 11093 |
| Immunogène | ADAMTS13 (NP_620594, 1328 a.a. ~ 1428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESE SSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT* |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | ADAM metallopeptidase with thrombospondin type 1 motif, 13 This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates at least four transcript variants encoding different isoforms. Mouse polyclonal antibody raised against a partial recombinant ADAMTS13. Synonyms: C9orf8, DKFZp434C2322, MGC118899, MGC118900, TTP, VWFCP, vWF-CP |
| Hôte | Mouse |
Applications: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
Informations supplémentaires: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 (ADAMTS13) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène ADAMTS13 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène ADAMTS13 (Bioinformatic Harvester (EMBL)) |
