Sie sind hier: Startseite » Produktdetails für "aarF domain containing kinase 4 ADCK4 Human"

Produktdetails für aarF domain containing kinase 4 (ADCK4) (Human) antibody

Druckversion

aarF domain containing kinase 4 (ADCK4) (Human) antibody

Übersicht


	Antigen:	AarF domain containing kinase 4 (ADCK4)
	Antikörper-Typ:	Monoklonal
	Applikation:	Western Blotting (WB), ELISA
	Reaktivität:	Human
	Wirt:	Mouse
	Menge:	100 µg
	Preis:	396,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt)
	Bestellnummer:	ABIN169379
	Verfügbarkeit:	Delivery in 7 to 10 days

Antigen	AarF domain containing kinase 4 (ADCK4)
Gen-ID	79934
Immunogen	ADCK4 (AAH13114, 445 a.a. ~ 545 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLAC AHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS*
Reaktivität	Human
Antikörper-Typ	Monoklonal
Isotyp	IgG2b Kappa »Passende Sekundärantikörper
Beschreibung	AarF domain containing kinase 4 Mouse monoclonal antibody raised against a partial recombinant ADCK4. Synonyms: FLJ12229
Klon	1D9
Wirt	Mouse

Applikation	Western Blotting (WB), ELISA
Applikationshinweise	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.74 KDa) .
Lagerung	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Beschränkungen	For Research Use only

Western Blot detection against Immunogen (36.74 KDa) .

Bild für aarF domain containing kinase 4 (ADCK4) (Human) antibody (1)

Google Scholar	Suchen Sie in Google Scholar™ nach weiteren Artikeln für Klon 1D9
EMBL Harvester	Genom von Mensch, Maus oder Ratte nach Antigen ADCK4 durchsuchen (Bioinformatic Harvester (EMBL))