PANIER
AIDE
Antigènes
Détail du produit pour aarF domain containing kinase 4 (ADCK4) (Human) antibody
aarF domain containing kinase 4 (ADCK4) (Human) antibody
Aperçu
|
|
| Antigène: | AarF domain containing kinase 4 (ADCK4) |
| Type anticorps: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 396,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN169379 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: aarF domain containing kinase 4 (ADCK4) (Human) antibody
| Antigène | AarF domain containing kinase 4 (ADCK4) |
| ID gène | 79934 |
| Immunogène | ADCK4 (AAH13114, 445 a.a. ~ 545 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLAC AHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS* |
| Reactivité | Human |
| Type anticorps | Monoclonal |
| Isotype | IgG2b Kappa »Anticorps secondaires correspondants |
| Description | AarF domain containing kinase 4 Mouse monoclonal antibody raised against a partial recombinant ADCK4. Synonyms: FLJ12229 |
| Clone | 1D9 |
| Hôte | Mouse |
Applications: aarF domain containing kinase 4 (ADCK4) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.74 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: aarF domain containing kinase 4 (ADCK4) (Human) antibody
|
Western Blot detection against Immunogen (36.74 KDa) . |
