Product details for  androgen receptor (dihydrotestosterone receptor, testicul...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR) (Human) antibody

Overview

Image for androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR) (Human) antibody
Antigen: Androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR)
Antibody Type: Monoclonal
Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN165648
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR) (Human) antibody

back to top ^


Antigen Androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR)
Gene ID 367
Immunogen AR (NP_000035, 221 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGV PPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG1 kappa »Matching secondary antibodies
Description Androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) The androgen receptor gene is more than 90 kb long and codes for a protein that has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract causes spinal bulbar muscular atrophy (Kennedy disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS). Two alternatively spliced variants encoding distinct isoforms have been described. Mouse monoclonal antibody raised against a partial recombinant AR. Synonyms: AIS, DHTR, HUMARA, KD, NR3C4, SBMA, SMAX1, TFM
Clone 1G3
Host Mouse

Application Details:  androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR) (Human) antibody

back to top ^


Application Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to AR (H00000367-M01) on formalin-fixed paraffin-embedded human renal cell carcinoma tissue. [antibody concentration 3ug/ml]

Image for androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR) (Human) antibody (2)

The detection limit for recombinant GST tagged AR is approximately 0.1ng/ml as a capture antibody.

Image for androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR) (Human) antibody (3)

External Information:  androgen receptor (dihydrotestosterone receptor, testicular feminization, spinal and bulbar muscular atrophy, Kennedy disease) (AR) (Human) antibody

back to top ^


Google Scholar Find more references for clone 1G3 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen AR (Bioinformatic Harvester (EMBL))