You are here: Homepage » Product details for "armadillo repeat containing 4 ARMC4 Human"

Product details for armadillo repeat containing 4 (ARMC4) (Human) antibody

Print Version

armadillo repeat containing 4 (ARMC4) (Human) antibody

Overview


	Antigen:	Armadillo repeat containing 4 (ARMC4)
	Antibody Type:	Monoclonal
	Application:	ELISA, Western Blotting (WB)
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN169048
	Availability:	Delivery in 7 to 10 days

Antigen	Armadillo repeat containing 4 (ARMC4)
Gene ID	55130
Immunogen	ARMC4 (NP_060546, 945 a.a. ~ 1045 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCIT MHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKARYT*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG1 Kappa »Matching secondary antibodies
Description	Armadillo repeat containing 4 Mouse monoclonal antibody raised against a partial recombinant ARMC4. Synonyms: DKFZP434P1735, FLJ10376, FLJ10817, FLJ32798, RP11-691I13.1
Clone	5F1
Host	Mouse

Application	ELISA, Western Blotting (WB)
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for armadillo repeat containing 4 (ARMC4) (Human) antibody (1)

The detection limit for recombinant GST tagged ARMC4 is approximately 1ng/ml as a capture antibody.

Image for armadillo repeat containing 4 (ARMC4) (Human) antibody (2)

Google Scholar	Find more references for clone 5F1 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen ARMC4 (Bioinformatic Harvester (EMBL))