Product details for  arsA arsenite transporter, ATP-binding, homolog 1 (bacter...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) (Human) antibody

Overview

Image for arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) (Human) antibody
Antigen: ArsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1)
Antibody Type: Monoclonal
Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Reactivity: Human, Mouse (Murine), Rat
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN165681
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) (Human) antibody

back to top ^


Antigen ArsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1)
Gene ID 439
Immunogen ASNA1 (NP_004308, 239 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQLVFPDPEKPCKMCE ARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ *
Reactivity Human, Mouse (Murine), Rat
Antibody Type Monoclonal
Isotype IgG1 Kappa »Matching secondary antibodies
Description ArsA arsenite transporter, ATP-binding, homolog 1 (bacterial) ASNA1 is the human homolog of the bacterial arsA gene. In E. coli, ArsA ATPase is the catalytic component of a multisubunit oxyanion pump that is responsible for resistance to arsenicals and antimonials.. Mouse monoclonal antibody raised against a partial recombinant ASNA1. Synonyms: ARSA-I, ARSA1, MGC3821
Clone 2H3
Host Mouse

Application Details:  arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) (Human) antibody

back to top ^


Application Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (38.21 KDa) .

Image for arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to ASNA1 (H00000439-M03) on formalin-fixed paraffin-embedded human testis. [antibody concentration 0 ug/ml]

Image for arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) (Human) antibody (2)

The detection limit for recombinant GST tagged ASNA1 is approximately 0.03ng/ml as a capture antibody.

Image for arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) (Human) antibody (3)

External Information:  arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 2H3 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ASNA1 (Bioinformatic Harvester (EMBL))