BASKET
HELP
Product details for asparagine-linked glycosylation 12 homolog (yeast, alpha-...
asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) (ALG12) (Human) antibody
Overview
|
|
| Antigen: | Asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) (ALG12) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human, Mouse (Murine), Rat |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN169329 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) (ALG12) (Human) antibody
| Antigen | Asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) (ALG12) |
| Gene ID | 79087 |
| Immunogen | ALG12 (NP_077010, 369 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPG TG* |
| Reactivity | Human, Mouse (Murine), Rat |
| Antibody Type | Monoclonal |
| Isotype | IgG1 Kappa »Matching secondary antibodies |
| Description | Asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. Mouse monoclonal antibody raised against a partial recombinant ALG12. Synonyms: ECM39, MGC111358, MGC3136, PP14673, hALG12 |
| Clone | 5000 |
| Host | Mouse |
Application Details: asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) (ALG12) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (32.38 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) (ALG12) (Human) antibody
|
Western Blot detection against Immunogen (32.38 KDa) .
The detection limit for recombinant GST tagged ALG12 is approximately 0.3ng/ml as a capture antibody. |
External Information: asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) (ALG12) (Human) antibody
| Google Scholar | Find more references for clone 5000 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen ALG12 (Bioinformatic Harvester (EMBL)) |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
