Product details for beta-Defensin 2 (aa 4-41) (Human) antibody
beta-Defensin 2 (aa 4-41) (Human) antibody
Overview
| Antigen: | Beta-Defensin 2 (aa 4-41) |
| Antibody Type: | Monoclonal |
| Application: | ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 98,00 € (Plus shipping costs and VAT) |
| Order number: | ABIN109995 |
| Availability: | Usually shipped within 2 days |
Additional Information: beta-Defensin 2 (aa 4-41) (Human) antibody
| Antigen | Beta-Defensin 2 (aa 4-41) |
| Immunogen | Synthetic human 61538-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP) |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 »Matching secondary antibodies |
| Description | Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4 |
| Clone | L12-4C-C2 |
| Host | Mouse |
| Specificity | Synthetic human 61538-Defensin 2 (aa 4-41) |
Application Details: beta-Defensin 2 (aa 4-41) (Human) antibody
| Application | ELISA |
| Application Notes | ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls. |
| Storage | 2-8 Degrees Celsius (lyophilized) - 20 Degrees Celsius (dissolved) Repeated thawing and freezing must be avoided |
| Research Area | Immunology |
| Restrictions | For Research Use only |
External Information: beta-Defensin 2 (aa 4-41) (Human) antibody
| Google Scholar | Find more references for clone L12-4C-C2 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen beta-Defensin 2 (aa 4-41) (Bioinformatic Harvester (EMBL)) |







