You are here: Homepage » Product details for "cAMP responsive element modulator CREM Human"

Product details for cAMP responsive element modulator (CREM) (Human) antibody

Print Version

cAMP responsive element modulator (CREM) (Human) antibody

Overview


	Antigen:	CAMP responsive element modulator (CREM)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN165976
	Availability:	Delivery in 7 to 10 days

Antigen	CAMP responsive element modulator (CREM)
Gene ID	1390
Immunogen	CREM (NP_853549, 201 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAA KECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG1 Kappa »Matching secondary antibodies
Description	CAMP responsive element modulator This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. Mouse monoclonal antibody raised against a partial recombinant CREM. Synonyms: ICER, MGC111110, MGC17881, MGC41893, hCREM-2
Clone	3B5
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for cAMP responsive element modulator (CREM) (Human) antibody (1)

Google Scholar	Find more references for clone 3B5 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen CREM (Bioinformatic Harvester (EMBL))