You are here: Homepage » Product details for "cadherin 1 type 1 Ecadherin epithelial CDH1 Human"

Product details for cadherin 1, type 1, E-cadherin (epithelial) (CDH1) (Human...

Print Version

cadherin 1, type 1, E-cadherin (epithelial) (CDH1) (Human) antibody

Overview


	Antigen:	Cadherin 1, type 1, E-cadherin (epithelial) (CDH1)
	Antibody Type:	Monoclonal
	Application:	Immunohistochemistry (IHC), Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN165869
	Availability:	Delivery in 7 to 10 days

Antigen	Cadherin 1, type 1, E-cadherin (epithelial) (CDH1)
Gene ID	999
Immunogen	CDH1 (NP_004351, 381 a.a. ~ 481 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGI LKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG1 Kappa »Matching secondary antibodies
Description	Cadherin 1, type 1, E-cadherin (epithelial) This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function is thought to contribute to progression in cancer by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. Identified transcript variants arise from mutation at consensus splice sites. Mouse monoclonal antibody raised against a partial recombinant CDH1. Synonyms: Arc-1, CDHE, ECAD, LCAM, UVO
Clone	3F4
Host	Mouse

Application	Immunohistochemistry (IHC), Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for cadherin 1, type 1, E-cadherin (epithelial) (CDH1) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to CDH1 (H00000999-M01) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

Image for cadherin 1, type 1, E-cadherin (epithelial) (CDH1) (Human) antibody (2)

Google Scholar	Find more references for clone 3F4 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen CDH1 (Bioinformatic Harvester (EMBL))