Product details for calcyphosine (CAPS) (Human) antibody
calcyphosine (CAPS) (Human) antibody
Overview
|
|
| Antigen: | Calcyphosine (CAPS) |
| Antibody Type: | Monoclonal |
| Application: | ELISA, Western Blotting (WB) |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN165810 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: calcyphosine (CAPS) (Human) antibody
| Antigen | Calcyphosine (CAPS) |
| Gene ID | 828 |
| Immunogen | CAPS (NP_004049, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGL VLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSG* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 Kappa »Matching secondary antibodies |
| Description | Calcyphosine This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. Mouse monoclonal antibody raised against a partial recombinant CAPS. Synonyms: CAPS1, MGC126562 |
| Clone | 4C6 |
| Host | Mouse |
Application Details: calcyphosine (CAPS) (Human) antibody
| Application | ELISA, Western Blotting (WB) |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.10 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: calcyphosine (CAPS) (Human) antibody
|
Western Blot detection against Immunogen (38.10 KDa) .
The detection limit for recombinant GST tagged CAPS is approximately 0.03ng/ml as a capture antibody. |








