Product details for cytochrome c oxidase subunit Vb (COX5B) (Human) antibody
cytochrome c oxidase subunit Vb (COX5B) (Human) antibody
Overview
|
|
| Antigen: | Cytochrome c oxidase subunit Vb (COX5B) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN165964 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: cytochrome c oxidase subunit Vb (COX5B) (Human) antibody
| Antigen | Cytochrome c oxidase subunit Vb (COX5B) |
| Gene ID | 1329 |
| Immunogen | COX5B (NP_001853, 37 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGC ICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLA* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 Kappa »Matching secondary antibodies |
| Description | Cytochrome c oxidase subunit Vb Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. Mouse monoclonal antibody raised against a partial recombinant COX5B. Synonyms: COXVB |
| Clone | 100000000 |
| Host | Mouse |
Application Details: cytochrome c oxidase subunit Vb (COX5B) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.23 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: cytochrome c oxidase subunit Vb (COX5B) (Human) antibody
|
Western Blot detection against Immunogen (36.23 KDa) . |
External Information: cytochrome c oxidase subunit Vb (COX5B) (Human) antibody
| Google Scholar | Find more references for clone 100000000 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen COX5B (Bioinformatic Harvester (EMBL)) |








