Product details for  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

Overview

Image for diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
Antigen: Diaphanous homolog 1 (Drosophila) (DIAPH1)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl (Product variants)
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170121
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

back to top ^


Antigen Diaphanous homolog 1 (Drosophila) (DIAPH1)
Gene ID 1729
Immunogen DIAPH1 (NP_005210, 921 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGF NISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS*
Reactivity Human
Antibody Type Polyclonal
Description Diaphanous homolog 1 (Drosophila) This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Mouse polyclonal antibody raised against a partial recombinant DIAPH1. Synonyms: DFNA1, DRF1, LFHL1, hDIA1
Host Mouse

Application Details:  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.55 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.55 KDa) .

Image for diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody (1)

External Information:  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

back to top ^


Google Scholar Find more references for antigen DIAPH1 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen DIAPH1 (Bioinformatic Harvester (EMBL))